Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648852.1	internal	285	2-856(+)
Amino Acid sequence :
LLGLFLASLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPF VLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLE KAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTP
Physicochemical properties
Number of amino acids:		285
Molecular weight:		31,316.131
Theoretical pI:		8.625
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33350 33350
Instability index:		42.887
aromaticity		0.095
GRAVY		-0.121
Secondary Structure Fraction
Helix		0.347
turn		0.312
sheet		0.204