Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648860.1	3prime_partial	216	73-720(+)
Amino Acid sequence :
MGPRWKGKGSEKIAASEPMSKIVDDLQSTLLQLGTHGLLLGSGVIVEATVELTNLLNRACFGRPIITSDVDNRWFQLNLEEAFYLSHELRCLKLVANCNESECPKNEDELWQYMKSKNTS FPEFYKAYSHLRKKNWVVRSGSQYGVDFVAYHHHPALVHAAFAVLVLSDSENYENHRLKVWSDFHSTVRLCGSVAKTLLVLNINKTDYDANSPLCL
Physicochemical properties
Number of amino acids:		216
Molecular weight:		24,474.626
Theoretical pI:		6.747
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39420 39795
Instability index:		46.551
aromaticity		0.097
GRAVY		-0.247
Secondary Structure Fraction
Helix		0.333
turn		0.236
sheet		0.273