Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648883.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
LRSSYFPLKSSKLLPKSHPCPLWSSSFSFCLDLRRHKSSITTTISTSSFCSSSATFMAATEPPSRAPEIETNPLVQDFEFPPFDVVEANHVRPGIRALLQQLENELIELEKTVEPTWPKL VVPLEKIVDRLQVVWGMVNHLKSVKDSSELRSAIEEVEPEKVKFLLRLGQSRPIYDAFKAIQESSSWQSLSDSQKRIVEGQIKEAVLNGVSLED | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 11,891.153 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 70.469 | ||
aromaticity | 0.086 | ||
GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.371 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648883.1 | complete | 114 | 420-76(-) |
Amino Acid sequence : | |||
MIDHPPYNLQSINNLFQRHDQLRPRWFHRLLQFNQLILKLLQQSSDPRPNVVGFNNIERRELEILNQRISFNLRRPRRRFGGSHESRRRRAERRGRNCGGDGGFVTTKIETEGK* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 11,891.153 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 70.469 | ||
aromaticity | 0.086 | ||
GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.371 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648883.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
SVLLIFPLSLPNFSRNPIPVLSGPRHFPSVSIFVVTNPPSPPQFLPLLSALRLRLSWLPPNLRLGRRRLKLILWFRISSSLRSMLLKPTTFGRGSELCCSNLRMS* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,891.153 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 70.469 | ||
aromaticity | 0.086 | ||
GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.371 | ||
sheet | 0.248 |