Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648890.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
FSSFFFIILIIFSSSLAQALVPRSKTFKFINEGDFGDGITENDASYRILRIFSDPFTLCFYNTTPDAYTLGLRMGNPSSESILRWAWDANRGNPVREKATLTFGRDGNLVLADSDGRVAW QTGTANKGVVDLKLLSNGNLVLLDARGRVVWQSFDYPVDTLLVGQALRANGPNKLTSWVVNRDGSLSEGPYSLVLEKRSLGLYLKSKNSPKPLLYYQYGEWPDPESTSLAKVVFNSVPES DKAYAFELRYDLYDKSNLSSPYRTSY | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 29,815.234 | ||
Theoretical pI: | 7.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53860 | ||
Instability index: | 34.112 | ||
aromaticity | 0.132 | ||
GRAVY | -0.257 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.293 | ||
sheet | 0.226 |