Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648896.1	internal	221	1-663(+)
Amino Acid sequence :
DNVDSNVGLPGLDISIAFPQATPASVFPPSASDYYHYDDLLTLEERELRRKVRAIMEKEVAPVMTEYWEKAKFPFQLIPKLAALGVAGGTIKGYECPGLSLTGSAIAIAEIARVDASCST FILVHSSLAMLTIALCGSEAQRKRYLPSLAQLQTIACWALTEPDFGSDASSLRTTARKVDGGWILDGQKRWIGNSTFADLLVIFARNTTTNQINGFIVKKD
Physicochemical properties
Number of amino acids:		221
Molecular weight:		24,073.320
Theoretical pI:		5.776
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30940 31190
Instability index:		46.107
aromaticity		0.086
GRAVY		0.038
Secondary Structure Fraction
Helix		0.317
turn		0.222
sheet		0.281