Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648897.1 | 5prime_partial | 225 | 3-680(+) |
Amino Acid sequence : | |||
LIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTMKHASELAHGANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGREDKSVPPPEGRLPDATKGTDHLRQVF VHQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTFNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLEDPVFCPLVKKYAADEDAFFKDYTEAHLKLSELGFADA* | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 24,703.777 | ||
Theoretical pI: | 5.340 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 32.188 | ||
aromaticity | 0.093 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.236 | ||
sheet | 0.289 |