Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648898.1 | internal | 230 | 1-690(+) |
Amino Acid sequence : | |||
GLKPLDLIKGGFPSGKYLFAGVVDGRNIWANDLAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVEVNALAKALSGQKDKEYFAANAAAQASRRSS PRVTNEAVQKAAAALKGSDHRRATNVSERLDAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEDDYIKAIKDEIAKVVKIQEELDIDVLVHGEPERNDMVEYF | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,273.562 | ||
Theoretical pI: | 7.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 34.356 | ||
aromaticity | 0.057 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.187 | ||
sheet | 0.304 |