Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648899.1 | 5prime_partial | 200 | 645-43(-) |
Amino Acid sequence : | |||
RPMYTTSNEFRDAPLRERMLEHLEPLFVKNKVTLALWGHVHRYERFCPLNNFTCGSNEKGETLPVHVVIGMGGQDWQPTWEPRADHPNDPVFPQPEWSLYRAGEFGYVRLVANKHKLTLT YIGNHDGKPHDMVEIPASGYDFNNGDDGSVEVKATVSWYTEIGSLLVLGAFVGYIIGFISRTRKASPANVGWTPVKSEEA* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 22,601.237 | ||
Theoretical pI: | 6.068 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
Instability index: | 28.568 | ||
aromaticity | 0.115 | ||
GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.270 | ||
sheet | 0.225 |