Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648904.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
RVTAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTN YHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKL | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 24,646.775 | ||
Theoretical pI: | 5.556 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
Instability index: | 28.804 | ||
aromaticity | 0.117 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.238 | ||
sheet | 0.283 |