Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648904.1	internal	223	2-670(+)
Amino Acid sequence :
RVTAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTN YHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKL
Physicochemical properties
Number of amino acids:		223
Molecular weight:		24,646.775
Theoretical pI:		5.556
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		42400 42400
Instability index:		28.804
aromaticity		0.117
GRAVY		-0.120
Secondary Structure Fraction
Helix		0.323
turn		0.238
sheet		0.283