Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648907.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
TFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIA VGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVY RNLFDALVDSVYASLEKAGGGGL | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 28,987.823 | ||
Theoretical pI: | 9.158 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 48.021 | ||
aromaticity | 0.103 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.297 | ||
sheet | 0.213 |