Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648914.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
TTSSPMAATVLLLGLFLPTLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEV SPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFD ALVDSVYASLEKAG | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,091.822 | ||
Theoretical pI: | 8.963 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.251 | ||
aromaticity | 0.098 | ||
GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.295 | ||
sheet | 0.213 |