Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648918.1 | 3prime_partial | 238 | 83-796(+) |
Amino Acid sequence : | |||
MFRRKPTHDHQDNSSEQDAKLNELRAAIGPLSGPSLQYCTDGCLRRYLEARNWNIEKSKKMLEESLRWRSTYKPEQIRWHEVANEGETGKMFRANFHDRHGRTVLILRPGMQNTSVVENQ IRHLVYLLENAILNLPEDQEQMVWLIDFTGLSLSNNVPIKAARETVNILQNHYPERLAIAFLYNPPRVFEALWKIVKYFLDTKTFQKVKFVYPKNKDSVELMSSYFDVENLPVEFGGK | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 27,942.589 | ||
Theoretical pI: | 8.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 61.806 | ||
aromaticity | 0.105 | ||
GRAVY | -0.594 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.218 | ||
sheet | 0.265 |