Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648924.1 | internal | 234 | 2-703(+) |
Amino Acid sequence : | |||
EEKYSNAFLGFGPEESHFVVELTYNYGVDSYDIGTGFGHFAIATEDVYKLVEDIRAKGGNITREPGPVKGGSTHIAFVKDPDGYIFELIQRGPTPEPLCQVMLRVGDLDRSIKFYEKALG MKLLRKIDNPAYKYTLAMMGYADEYETTVLELTYNYGVTEYTKGNAYAQIAISTDDVYKSAEAVKVVTQELGGKITREPGPIPGINTKITSFLDPDGWKTVLVDYADFLRSWSS | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 26,080.112 | ||
Theoretical pI: | 4.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36330 36330 | ||
Instability index: | 25.484 | ||
aromaticity | 0.124 | ||
GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.226 | ||
sheet | 0.231 |