Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648932.1 | complete | 227 | 47-730(+) |
Amino Acid sequence : | |||
MVSAAGESSGIPTQSSSCSGNGSNDAGNFECNICFDLAQDPVVTLCGHLFCWPCLYKWLHFHSHSQECPVCKALVEEEKLVPIYGRGKTPADPRTKSVPGIDIPSRPSGQRPETAPSAHA NEFPPHGFGFMGGFAPMATTRFGNFTLSAAFGGLIPSLFNLQVHGFPDATMYGAAAGFPYGFSNSFHGAHYHHGFPLRANPGQQADYYLKMLFLLVGVFVILALIWS* | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 14,802.155 | ||
Theoretical pI: | 5.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 48.018 | ||
aromaticity | 0.088 | ||
GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.168 | ||
sheet | 0.312 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648932.1 | complete | 125 | 297-674(+) |
Amino Acid sequence : | |||
MEGERRQRIQEPSQFLELTFLVDHLGRDLKQPLLRMLMNSLRMGLDSWVDSLQWQPQDLGTSHFQLLLVVSFHHFLTFRSMDFLTLLCMELLLASLMDFQIHFMGPIIIMDSHSERIQDS RQITI* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,802.155 | ||
Theoretical pI: | 5.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 48.018 | ||
aromaticity | 0.088 | ||
GRAVY | 0.050 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.168 | ||
sheet | 0.312 |