Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648938.1 | 3prime_partial | 241 | 11-733(+) |
Amino Acid sequence : | |||
MEKISASSMLLFLCIPVISFSWAASSSIATERLLQCLAVPSGPAIPVYTPNNSSYNSILQSKIQIVRFASSGIPKPRLIITPLHESHVQKAVICCRKHGFQMRTRSGGHDYEGLSYTTYN DIIPFVVLDLFNLQTISVDVEDGTAWVQAGATLAQVYYKIADKTSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNVDGKILNKDSMGEELFWAIRGGGGASFGIVL S | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 25,906.481 | ||
Theoretical pI: | 8.240 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31650 | ||
Instability index: | 24.899 | ||
aromaticity | 0.095 | ||
GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.286 | ||
sheet | 0.203 |