Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648957.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
AAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSATGLTFKYDTLLIATGSTVIRLTDFGVQ GADAKNIFYLREIDDADKLIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGIKIVKG | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 11,126.628 | ||
Theoretical pI: | 9.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 50.293 | ||
aromaticity | 0.105 | ||
GRAVY | 0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.333 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648957.1 | 3prime_partial | 105 | 316-2(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPVALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAA | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,126.628 | ||
Theoretical pI: | 9.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 50.293 | ||
aromaticity | 0.105 | ||
GRAVY | 0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.333 | ||
sheet | 0.267 |