Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648964.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
SCSSNMFLILKFLLLQAVLSAARDFDFFYFVQQWPGSYCDTKQSCCYPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFDPSEISDLTRTMQNEWPTLACPSGDGTKFWSHEWEKHGT CSESVLNQHGYFDAALNLKKQADLLNALVNAGIRPNGSSYSLLSIKNAIK | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,954.953 | ||
Theoretical pI: | 5.196 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38305 | ||
Instability index: | 35.902 | ||
aromaticity | 0.129 | ||
GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.306 | ||
sheet | 0.206 |