Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648964.1	internal	170	3-512(+)
Amino Acid sequence :
SCSSNMFLILKFLLLQAVLSAARDFDFFYFVQQWPGSYCDTKQSCCYPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFDPSEISDLTRTMQNEWPTLACPSGDGTKFWSHEWEKHGT CSESVLNQHGYFDAALNLKKQADLLNALVNAGIRPNGSSYSLLSIKNAIK
Physicochemical properties
Number of amino acids:		170
Molecular weight:		18,954.953
Theoretical pI:		5.196
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		37930 38305
Instability index:		35.902
aromaticity		0.129
GRAVY		-0.385
Secondary Structure Fraction
Helix		0.288
turn		0.306
sheet		0.206