Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648969.1	internal	143	2-430(+)
Amino Acid sequence :
DMTVEEIALGFVNVANETMCRPIRQLTEMKGHETRNHALACFGGAGPQHACAIARLLGMSEVLIHRFCGIVSAYGMGLADVIEEAQEPYSAVYDPKSALEASRREADLIKQVKQKLRGQG FGDGSIVTESFLNLRYEGTDTAI
Physicochemical properties
Number of amino acids:		143
Molecular weight:		15,574.593
Theoretical pI:		5.348
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6210
Instability index:		44.565
aromaticity		0.063
GRAVY		-0.110
Secondary Structure Fraction
Helix		0.273
turn		0.203
sheet		0.322