Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648971.1 | 5prime_partial | 152 | 1-459(+) |
Amino Acid sequence : | |||
LVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIETYIF AMFNEDRKSPEFEKHFGLFYPSKQPVYPINFA* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,000.918 | ||
Theoretical pI: | 6.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
Instability index: | 47.898 | ||
aromaticity | 0.138 | ||
GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.336 | ||
sheet | 0.204 |