Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648972.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
ALPNQQTVDYPSFKLVLVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIV LCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLAAQQQHEA | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 11,899.529 | ||
Theoretical pI: | 11.054 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 57.699 | ||
aromaticity | 0.068 | ||
GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.427 | ||
turn | 0.184 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648972.1 | 5prime_partial | 103 | 603-292(-) |
Amino Acid sequence : | |||
CFMLLLCGQVDLHFRRSKSRRLNKVKVRIASKLSGKIKKRLLKVVVAFGRNLIVLKILLPVECYLLCFHLSVFHINLVPAKNNRNILTHPAKVPVPRRDIFIC* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,899.529 | ||
Theoretical pI: | 11.054 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 57.699 | ||
aromaticity | 0.068 | ||
GRAVY | 0.374 | ||
Secondary Structure Fraction | |||
Helix | 0.427 | ||
turn | 0.184 | ||
sheet | 0.223 |