Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648977.1	internal	105	2-316(+)
Amino Acid sequence :
PPSNKMKFNIANPTTGCQKKLEIDDDQKLRAFFDGRISQEVSGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPNRVRLLLHRGTTCFRGYGRRKGERRRKSVR
Physicochemical properties
Number of amino acids:		105
Molecular weight:		11,966.703
Theoretical pI:		10.204
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3105
Instability index:		43.927
aromaticity		0.086
GRAVY		-0.846
Secondary Structure Fraction
Helix		0.238
turn		0.248
sheet		0.171