Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648981.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
RNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRSSILSADPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGG LVARPVLTSYYKSDHFKTRPYDPYMVY | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,899.130 | ||
Theoretical pI: | 9.222 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16390 | ||
Instability index: | 53.922 | ||
aromaticity | 0.109 | ||
GRAVY | -0.532 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.238 | ||
sheet | 0.238 |