Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648987.1 | internal | 164 | 3-494(+) |
Amino Acid sequence : | |||
PKMESSRRSNRGIEENILAILDPSGVKEARDVHDDQLAFLEAVRAASLVSEAGTAPTRKMLEAIFQILKEGTSLELTMASYLLLSELDKHYPELHSSHRDTSEFNGSKVCNSLEVKETWS PFTFGSEIAYSERDATYKSSGNPLDPNGFSLLTQNIAQAFEKIE | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,211.117 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 52.120 | ||
aromaticity | 0.073 | ||
GRAVY | -0.449 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.256 | ||
sheet | 0.323 |