Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648992.1 | internal | 170 | 1-510(+) |
Amino Acid sequence : | |||
SFNQRSNMITIPYTTALTTLFSYGLLFAFGEIRDLFRKFIDWWTSNGLQGYAPICLGLEDFYVRRLYLRIQDCFGRPIASAPDAWIDVVERYSNDSNKTLKRTSKINRCLNLGSYNYLGF AAADEYCTPRVIESLKRFSASTCSTRVDGGTTKLHTELEESVARFVGKSA | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,334.740 | ||
Theoretical pI: | 8.825 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 36.806 | ||
aromaticity | 0.135 | ||
GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.229 | ||
sheet | 0.224 |