Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648993.1	internal	110	332-3(-)
Amino Acid sequence :
HVKTQPPPNLRQLPGNASVDPVMIQIQRYQILLRKPQRRHIELQDVPRQIYVPQRFLLPEQHRRVSLQRVPRQIDRVQVQVPQRRGDPTGELVVRQHEVLQGSGEPPEGF
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,311.810
Theoretical pI:		6.113
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		34.103
aromaticity		0.082
GRAVY		-0.229
Secondary Structure Fraction
Helix		0.345
turn		0.291
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648993.1	internal	110	3-332(+)
Amino Acid sequence :
ESFGRFSGSLKYLVLSHNQLSGRIPATLGNLDLDTIDLSRNTLEGDASMLFGEQKSLRDVDLSRNVLEFDMSTLRFPKKNLVALDLNHNGIYGSIPRQLTEVGRWLGFNV
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,311.810
Theoretical pI:		6.113
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		34.103
aromaticity		0.082
GRAVY		-0.229
Secondary Structure Fraction
Helix		0.345
turn		0.291
sheet		0.264