Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648995.1 | internal | 186 | 3-560(+) |
Amino Acid sequence : | |||
APPFLFPPMDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKKFRGSDKPPSHLGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLSFKAVDGSYVFNK GKIHKVPATDIEALKSPLMGIFEKRRARKFFIYVQDYEENDPKTHEGMDLTRITTRELIAKYGLDA | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 12,906.739 | ||
Theoretical pI: | 8.940 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 44.662 | ||
aromaticity | 0.088 | ||
GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.230 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648995.1 | 5prime_partial | 113 | 560-219(-) |
Amino Acid sequence : | |||
GIKTVFSNKLSGSNSSKIHSLMCLRVIFLIVLNIYEEFASTALLKYSHERRFQGLNVSCRHFVNLSFVKDVTSINSLKAEIFCNIRVNEDAHQSTISHHELWDHVHIIIPARA* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,906.739 | ||
Theoretical pI: | 8.940 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 44.662 | ||
aromaticity | 0.088 | ||
GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.230 | ||
sheet | 0.212 |