Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649007.1 | internal | 118 | 2-355(+) |
Amino Acid sequence : | |||
VFGVSEFFQVMAARRISTLLSRSLNPSLRSLGKNSSWSRGGISRFGTAAVVEEPITPSVQVNHNQLLINGQFVDAASGRTFPTLDPRTGEIIAHVAEADSEDVNRAVSAARKAFDEGP | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,655.004 | ||
Theoretical pI: | 6.923 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 42.358 | ||
aromaticity | 0.068 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.297 | ||
sheet | 0.246 |