Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649008.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
SKMALPNQQVVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENI PIVLCGNKVDVKNRQVKAKQVIFHRKKNLQYY | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,332.014 | ||
Theoretical pI: | 6.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 51.179 | ||
aromaticity | 0.060 | ||
GRAVY | 0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.199 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649008.1 | 5prime_partial | 151 | 458-3(-) |
Amino Acid sequence : | |||
VILKIFLSMKYHLLCFNLPVLDINLVSAENNGNVLTHPAEVSMPGRNILVCQTRSYIKHDDCTLSMDIISVSESTKFLLTSCVPTVEPNLPTVSEEIQRMNFHTDRWLVFLLELSREMPL HKCSLSCATVTDDHELETRVIHDLLVRKRHF* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,332.014 | ||
Theoretical pI: | 6.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 51.179 | ||
aromaticity | 0.060 | ||
GRAVY | 0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.199 | ||
sheet | 0.265 |