Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649012.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
SKVDETVERAKREGNLPLFGFHDPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCIIDGGNEWDQNTERREQAMAELGLLYLGMGVSGGEEGARH | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,390.779 | ||
Theoretical pI: | 4.977 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 34.517 | ||
aromaticity | 0.058 | ||
GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.233 | ||
sheet | 0.282 |