Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649013.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
KLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQS TCATSGEGLYEGLDWLSN | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 12,233.171 | ||
Theoretical pI: | 5.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 43.631 | ||
aromaticity | 0.055 | ||
GRAVY | 0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.193 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649013.1 | 3prime_partial | 109 | 327-1(-) |
Amino Acid sequence : | |||
MQTKLVCDFSSIHCIRQILLVGEDKKHSIPQFILIQHSVKLIPCFYNSIPIIAVNNKDETLCILEIVAPQWSDLVLATNIPDSKADILVLHCLNIETDGWDSGHDLAKL | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,233.171 | ||
Theoretical pI: | 5.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 43.631 | ||
aromaticity | 0.055 | ||
GRAVY | 0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.193 | ||
sheet | 0.220 |