Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649026.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
FLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPA MRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVF | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 11,657.195 | ||
Theoretical pI: | 9.463 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 30.003 | ||
aromaticity | 0.118 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.333 | ||
sheet | 0.098 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649026.1 | 5prime_partial | 102 | 478-170(-) |
Amino Acid sequence : | |||
ENSSRWRVGICNNSSINGSRNFDSILKPSSCNCIVDVSHGWKNKRNVLGFANWTHFITNGNVLDPHITVVSNVLLNPVISKAWVICYSLKIWVRYTEYKFNV* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,657.195 | ||
Theoretical pI: | 9.463 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 30.003 | ||
aromaticity | 0.118 | ||
GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.333 | ||
sheet | 0.098 |