Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649028.1	internal	183	1-549(+)
Amino Acid sequence :
LLLACSFSFLVLVLLLLLCRAPEAMAAFAGTTQKCKACEKTVYLVDQLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRPHFDQLFKRTGSLDKSFEGTPKIVKPEKHIDPENAA TNKVLNKFAGTREKCVGCKKTVYPIEKVAVDGSVYHRSCFKCSHGGCVISPSNYIAHEGKLYC
Physicochemical properties
Number of amino acids:		183
Molecular weight:		15,081.570
Theoretical pI:		4.969
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22835
Instability index:		26.064
aromaticity		0.141
GRAVY		0.600
Secondary Structure Fraction
Helix		0.393
turn		0.207
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649028.1	5prime_partial	135	549-142(-)
Amino Acid sequence :
AVELPLMCDIVRWANNTPSMTAFETAPVIYTPIYCNLFNWIYSLFAPNTFFPGPCKFVQYFVCCGILWVDVFLRFHNFGSSFETLVKTASSLEKLIKVRPAIQDSFKGIVIAELEGTSAM MATEAGLVIDTVICC*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		15,081.570
Theoretical pI:		4.969
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22835
Instability index:		26.064
aromaticity		0.141
GRAVY		0.600
Secondary Structure Fraction
Helix		0.393
turn		0.207
sheet		0.244