Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649029.1 | internal | 104 | 3-314(+) |
Amino Acid sequence : | |||
WKGLAKIQTNRRHNGICHDDSTTPVKAQTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQMLQLQSISASLASLTRETGPKLVRGDQARKVEAAKVSNVVD | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,405.778 | ||
Theoretical pI: | 9.209 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 39.427 | ||
aromaticity | 0.019 | ||
GRAVY | -0.640 | ||
Secondary Structure Fraction | |||
Helix | 0.221 | ||
turn | 0.202 | ||
sheet | 0.240 |