Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649035.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
KHFKYVIIGGGVAAGYAAREFAKQGVKPGELGIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEQGIELILSTEIVKVDLASKSLVSAAGLTFKYDTLLIATG STVIRLTDFGVQGADAKNIFYLREIDDADKLIAAIN | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 12,473.308 | ||
Theoretical pI: | 9.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 47.192 | ||
aromaticity | 0.103 | ||
GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.333 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649035.1 | 3prime_partial | 117 | 352-2(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPAALTRDFEARSTFTISVLRINSMPCSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIPSSPGLTPCFANSLAAYPAATPPPMITYLKCF | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,473.308 | ||
Theoretical pI: | 9.670 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 47.192 | ||
aromaticity | 0.103 | ||
GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.333 | ||
sheet | 0.256 |