Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649037.1	internal	184	2-553(+)
Amino Acid sequence :
SLSLLLVAINALATLAQGLPRAVLDTAGRPLRTGTQYYIIRRSAPGINGPGLTLVRPNGSCPLYVGLQGKTIGSSNGLPVTFLPFVSDETVIRESSDFSVSFVASTTTCPESTTDWAIDQ ASDPNMSGRTLITTRRENQPSDFFRILRDGRETYKLHYCPTEACPQCRFRCGDIGLSRNEGNLL
Physicochemical properties
Number of amino acids:		184
Molecular weight:		19,782.223
Theoretical pI:		10.238
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 32220
Instability index:		51.832
aromaticity		0.056
GRAVY		-0.565
Secondary Structure Fraction
Helix		0.251
turn		0.302
sheet		0.179

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649037.1	5prime_partial	179	553-14(-)
Amino Acid sequence :
QEIPFVPRKTNITTPKATLRTGLSWAIMQLIRLSSISQDPEKITGLVLPPRRDQCPATHVRIRSLINGPVCGRLRASRCGSHKADREVARFPYNSLIGDEWEEGDWKTVGRSNCLALQPN VQWARTVWSNQGQARSINPGSTSAYDIVLGSGSKRSSCSVEHRTGQALGKRSQSVNGYK*
Physicochemical properties
Number of amino acids:		179
Molecular weight:		19,782.223
Theoretical pI:		10.238
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 32220
Instability index:		51.832
aromaticity		0.056
GRAVY		-0.565
Secondary Structure Fraction
Helix		0.251
turn		0.302
sheet		0.179