Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649037.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
SLSLLLVAINALATLAQGLPRAVLDTAGRPLRTGTQYYIIRRSAPGINGPGLTLVRPNGSCPLYVGLQGKTIGSSNGLPVTFLPFVSDETVIRESSDFSVSFVASTTTCPESTTDWAIDQ ASDPNMSGRTLITTRRENQPSDFFRILRDGRETYKLHYCPTEACPQCRFRCGDIGLSRNEGNLL | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,782.223 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 51.832 | ||
aromaticity | 0.056 | ||
GRAVY | -0.565 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.302 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649037.1 | 5prime_partial | 179 | 553-14(-) |
Amino Acid sequence : | |||
QEIPFVPRKTNITTPKATLRTGLSWAIMQLIRLSSISQDPEKITGLVLPPRRDQCPATHVRIRSLINGPVCGRLRASRCGSHKADREVARFPYNSLIGDEWEEGDWKTVGRSNCLALQPN VQWARTVWSNQGQARSINPGSTSAYDIVLGSGSKRSSCSVEHRTGQALGKRSQSVNGYK* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,782.223 | ||
Theoretical pI: | 10.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 51.832 | ||
aromaticity | 0.056 | ||
GRAVY | -0.565 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.302 | ||
sheet | 0.179 |