Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649058.1	3prime_partial	229	93-779(+)
Amino Acid sequence :
MMDGQVLDDIIRRLLDGKGGKQVQLSEAEIRQLCVNARHLFLSQPNLLHLRAPIKICGDIHGQYLDLLRLFEYGGFPPTSTYLFLGDYVDRGKQSLETICLLLAYKIKYPDKIFLLRGNH EDAKINRIYGFYDECKRRFNVRLWKIFTECFNCLPVAALIDDKILCMHGGLSPELENVNQIAEIERPTEIPDNGLLCDLLWSDPDQSVEGWADSDRGVSCTFGADRVVE
Physicochemical properties
Number of amino acids:		229
Molecular weight:		26,137.787
Theoretical pI:		5.196
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28420 28920
Instability index:		51.414
aromaticity		0.092
GRAVY		-0.164
Secondary Structure Fraction
Helix		0.354
turn		0.201
sheet		0.258