Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649079.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
AKTPAIPNRCGSKQARFISCEKKQGGEHGHENHVIDRRNVLLGIGGLYGATATIGSQGKVAIGAPVQPPDLSKCHLALDSDAGQEVNCCPPYSTANIIDFVPPSHDERLRRRKPAHMLNP EEIEKFKTAIAKMKALDKDDPWNFMQQATIHCTYCNGAFDQVGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRMPEFYLDKMSPLYNDNRNHNHYNAL MDYDYSIGDPNPTP | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 28,907.396 | ||
Theoretical pI: | 6.263 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
Instability index: | 52.760 | ||
aromaticity | 0.110 | ||
GRAVY | -0.587 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.260 | ||
sheet | 0.220 |