Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649082.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAG | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 28,455.233 | ||
Theoretical pI: | 9.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 46.988 | ||
aromaticity | 0.101 | ||
GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.292 | ||
sheet | 0.214 |