Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649129.1	internal	281	1-843(+)
Amino Acid sequence :
FNLSLFLILVFSILLALPGSIANDESFLQCLSAHSSQPPMPIYNPNTSDYSSILQSTIQNLRFSTPTTPKPHLIITPLHESHVQAAVICCKKHGMQMKIRSQGHDFEGLSYTSYVPFVIL DLFNFKSISVDVEAGTAWVQVGATIGQLYYTIAERSRTHAFQAGVCPSVGVGGQFSGGGYGYLLRKYGLAADNIIDALIVNADGKILNREQMGEDLFWAIRGGGGASFGVILEWKIKLVP VPSTVTVFTVPRTLEQGATAIVHKWQNIAHKLPKELVIRVL
Physicochemical properties
Number of amino acids:		281
Molecular weight:		30,715.149
Theoretical pI:		8.339
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35410 35660
Instability index:		33.735
aromaticity		0.096
GRAVY		0.207
Secondary Structure Fraction
Helix		0.363
turn		0.256
sheet		0.224