Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649142.1 | 3prime_partial | 117 | 58-408(+) |
Amino Acid sequence : | |||
MATPREENVYMAKLAEQAERYEEMVEFMEKVTAAVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVATIRDYRSKIEAELTSICDGILRLLDSRLIPSASS | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,338.871 | ||
Theoretical pI: | 4.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 60.262 | ||
aromaticity | 0.051 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.179 | ||
sheet | 0.368 |