Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649146.1 | 5prime_partial | 113 | 433-92(-) |
Amino Acid sequence : | |||
IDLSRNTLEGDVSMLFGEKKSLRDVDLSRNVLEFDMSTLRFPKKTLVALDLNHNRIYGSIPRQLTKVGTLLGFNVSYNRLCGEIPQGGKLQSFDSSTYFHNRCLCGAPLPKCK* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,709.543 | ||
Theoretical pI: | 9.210 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 42.530 | ||
aromaticity | 0.080 | ||
GRAVY | -0.290 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.274 | ||
sheet | 0.221 |