Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649146.1	5prime_partial	113	433-92(-)
Amino Acid sequence :
IDLSRNTLEGDVSMLFGEKKSLRDVDLSRNVLEFDMSTLRFPKKTLVALDLNHNRIYGSIPRQLTKVGTLLGFNVSYNRLCGEIPQGGKLQSFDSSTYFHNRCLCGAPLPKCK*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		12,709.543
Theoretical pI:		9.210
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4720
Instability index:		42.530
aromaticity		0.080
GRAVY		-0.290
Secondary Structure Fraction
Helix		0.319
turn		0.274
sheet		0.221