Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649154.1	5prime_partial	279	1-840(+)
Amino Acid sequence :
TFISIMILMLLSIISMQQAYSSSGNVTNHEKKNFVLVHGAGHGAWCYYKLITLLRSAGHNVTALDLAAAGINPKQVLELRSISDYHEPLIKFMESIPENERVILVGHSLGGFGISQAMET FPDKIAAGVFVTALMPGPELDAYTVYQKGLQQLNDTMDTKITVKYGPDNSSITITLFGPKFLGARLYQLSPPQDLTLATTLIRPFRDFSEKDMNKVIALSNEKYGRVSRVFIISKEDLAL TEDFQRWMIKKNPGAAVKEIKDSDHMVMLSKPHELFSLL*
Physicochemical properties
Number of amino acids:		279
Molecular weight:		31,081.722
Theoretical pI:		7.052
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24410 24410
Instability index:		31.019
aromaticity		0.086
GRAVY		-0.001
Secondary Structure Fraction
Helix		0.337
turn		0.229
sheet		0.272