Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649156.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
KRIVLEADGYQPYLISPEKGLRSLIKGVLDLAKEPSRLCVDEVHHVLVDIVSTAANSTPGLGRYPPFKREVISIASAALDGFKNEAKKMVVALVDMERVFVPPQHFIRLVQRRMERQRRE EEQRNRSSKKGQEAEQTLLNRATSPQTGQQTGGSLKSMKDKSTQPEKDTQEGSALKTAGASKEITAGYLLKKSSKKNGWSRRWFVLNEKSGKLGYTKKEDEKHFHGVITLEECNIEELAD EEEPPQKGSKDKK | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,457.071 | ||
Theoretical pI: | 9.379 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 51.590 | ||
aromaticity | 0.051 | ||
GRAVY | -0.831 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.225 | ||
sheet | 0.269 |