Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649163.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
PHWKESVQVSKDCLGSVVLPMGNLATGLCQHRALLFKVLADTINLPCRIAKGCKYCKRNDASSCLVRFGHDRELFVDLIGKPGSFCEPDSLLNGPTSISISSPLRLPKFKPVETNESCGS LAKKYFVDSQPLDLLFGESSACIETTDDTKPLFPKHMNRNRISVSDDTDEMPVSRLPQRIPQPNEHNRDSQLQSSSNLSWNVISSIDLAKDPIPPKHIPPYALKDVQTIGFSNPRANTGR DQRFMEGVQLVPS | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,027.705 | ||
Theoretical pI: | 8.226 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15970 | ||
Instability index: | 42.241 | ||
aromaticity | 0.059 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.304 | ||
sheet | 0.198 |