Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649177.1 | internal | 217 | 1-651(+) |
Amino Acid sequence : | |||
LQSSVVGIIDDDTVTPEKLVRKRLMSPLNGMLYPNKFCGDPLEPIGKNFQIESSVLSDKFNVILSQDHKKANTASSNSLESPIPSPSSYSNWDSTLAGKSITCSTFTDGPLLEHEEIVHP HRNSSSLLETIPIGETMKVRSQTGVLSISPKKVHSPPLSLSPLGPKFSERMKVAEAGKNSRKKIEGEHFILKNIERSLDRAVSGVLFSQEEDEFSIF | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 23,876.833 | ||
Theoretical pI: | 6.345 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 58.873 | ||
aromaticity | 0.055 | ||
GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.327 | ||
sheet | 0.221 |