Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649179.1	5prime_partial	156	1-471(+)
Amino Acid sequence :
NRLTGPIPESFGRFSGSLKYLVLSHNQLSGRIPATLRNVDLDTIDLSRNTLEGDVSMLFGEKKSLRDVDLSRNVLEFDMSTLRFPKKTLVALDLNHNRIYGSIPRQLTKVGTLLGFNVSY NRLCGEIPQGGKLQSFDSSTYFHNRCLCGAPLPKCK*
Physicochemical properties
Number of amino acids:		156
Molecular weight:		17,432.851
Theoretical pI:		9.474
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6210
Instability index:		36.822
aromaticity		0.077
GRAVY		-0.287
Secondary Structure Fraction
Helix		0.321
turn		0.295
sheet		0.218