Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649179.1 | 5prime_partial | 156 | 1-471(+) |
Amino Acid sequence : | |||
NRLTGPIPESFGRFSGSLKYLVLSHNQLSGRIPATLRNVDLDTIDLSRNTLEGDVSMLFGEKKSLRDVDLSRNVLEFDMSTLRFPKKTLVALDLNHNRIYGSIPRQLTKVGTLLGFNVSY NRLCGEIPQGGKLQSFDSSTYFHNRCLCGAPLPKCK* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,432.851 | ||
Theoretical pI: | 9.474 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 36.822 | ||
aromaticity | 0.077 | ||
GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.295 | ||
sheet | 0.218 |