Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649186.1 | 3prime_partial | 194 | 172-753(+) |
Amino Acid sequence : | |||
MAELGKERIHASIVAEDEGGNSLRKNKWVPASSSKGRYIHMENHVHPNSSSSDSQSKSSCFICSGNGSCKTVRSRTKLMNSLIEQGKSSEVQSIFESLIEEGHRPSLITYTTLLASLTIQ KRFNGVPSIIAQVEANGMKPDSIFFNAVINAFSESGNMEEAMKSLLKMKENGCHPTTSTFNTLIKGYGISGKPE | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,146.707 | ||
Theoretical pI: | 8.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 48.943 | ||
aromaticity | 0.057 | ||
GRAVY | -0.434 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.335 | ||
sheet | 0.232 |