Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649196.1 | 3prime_partial | 133 | 161-559(+) |
Amino Acid sequence : | |||
MAQYIPTLDYYSGGLPLACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMGYFEFLPHDPSFAYSTLNPQLLVDLVDVEIGKEYELVITTYSGLCRYRVGDILRVTGFHNSAPQFHFVKR KNVLLSIDSDKTD | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,088.174 | ||
Theoretical pI: | 5.243 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16640 | ||
Instability index: | 39.101 | ||
aromaticity | 0.135 | ||
GRAVY | -0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.248 | ||
sheet | 0.233 |