Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649213.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
LPHTLTTTTIVSSNSSLSSSCSLFHPKTSQVNLSGKQIRQHRSIVPRNVTCSSNRKSGENRSSSSINDHHEEYPNALVDRRNMLLGLGAGLYGFAGLTVADRLAAGAPIIPPDLSKCGPA DLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHNSWLFFPWHRYYLYFYE | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 25,626.699 | ||
Theoretical pI: | 8.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26275 | ||
Instability index: | 47.037 | ||
aromaticity | 0.091 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.293 | ||
sheet | 0.220 |