Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649219.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
KRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVISSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL DPVRWPNSYWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHPGVSSLHDNKDDASLMWLRGDMGDRGFQSLNFQGLGISPWLQQRIDPSLLRNDHDQQYQAIAAA ALQDIRGGDPLKQQYLQ | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 29,231.994 | ||
Theoretical pI: | 9.646 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55920 55920 | ||
Instability index: | 64.588 | ||
aromaticity | 0.101 | ||
GRAVY | -0.364 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.261 | ||
sheet | 0.237 |